PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10013447
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family MYB
Protein Properties Length: 302aa    MW: 31678.1 Da    PI: 6.8002
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10013447genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding31.93e-101154344
                     SS-HHHHHHHHHHHHHTTTT...-HHHHHHHHTTTS-HHHHHHHH CS
  Myb_DNA-binding  3 rWTteEdellvdavkqlGgg...tWktIartmgkgRtlkqcksrw 44
                     +WT e d+ + +a + ++ +   +W++Ia  +  g+tl+++k+++
      Lus10013447 11 SWTREQDKAFENALATYPEDdsdRWEKIATDVE-GKTLEEVKDHF 54
                     7********************************.**********8 PP

2Myb_DNA-binding43.86e-14123167347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT++E+ l++ + +++G+g+W++I+r +  +Rt+ q+ s+ qky
      Lus10013447 123 AWTEDEHRLFLLGLEKYGKGDWRSISRNFVVTRTPTQVASHAQKY 167
                      6*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512938.571762IPR017884SANT domain
SMARTSM007173.6E-9860IPR001005SANT/Myb domain
PfamPF002491.4E-71154IPR001005SANT/Myb domain
CDDcd001671.21E-81158No hitNo description
Gene3DG3DSA:1.10.10.601.3E-41154IPR009057Homeodomain-like
SuperFamilySSF466898.28E-111165IPR009057Homeodomain-like
PROSITE profilePS5129417.61115172IPR017930Myb domain
SuperFamilySSF466898.97E-17118173IPR009057Homeodomain-like
TIGRFAMsTIGR015571.5E-17120170IPR006447Myb domain, plants
SMARTSM007174.5E-11120170IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.3E-11123166IPR009057Homeodomain-like
CDDcd001671.36E-10123168No hitNo description
PfamPF002497.5E-12123167IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 302 aa     Download sequence    Send to blast
MAVDEVGSSC SWTREQDKAF ENALATYPED DSDRWEKIAT DVEGKTLEEV KDHFDLLLED  60
IGLIESGCVP LPSYNSSSES STSHGGDEGT GKKGGHGGGN NNSESNQGNK GSRADQERRK  120
GIAWTEDEHR LFLLGLEKYG KGDWRSISRN FVVTRTPTQV ASHAQKYFIR LNSMNKDRRR  180
SSIHDITSLN NGEIAAAQGP ITGQTNGASA GVGGSGKAGK QPSQHPGGPP GVVGIYGAPT  240
IGQPIGGPLV SAVGTPVNLA SPSHMAFGVR ARVPGAMVPG APMTMGGPMA YPMPPTTSAH  300
R*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2cjj_A2e-19777676RADIALIS
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00500DAPTransfer from AT5G08520Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008360003.11e-168PREDICTED: transcription factor DIVARICATA-like
RefseqXP_008360004.11e-168PREDICTED: transcription factor DIVARICATA-like
RefseqXP_008360005.11e-168PREDICTED: transcription factor DIVARICATA-like
RefseqXP_008360006.11e-168PREDICTED: transcription factor DIVARICATA-like
SwissprotQ8S9H72e-62DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLD9ZJ781e-168D9ZJ78_MALDO; MYBR domain class transcription factor
STRINGGLYMA07G28310.11e-160(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF46943358
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G08520.11e-102MYB family protein